PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Vang0017s00100.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
Family ZF-HD
Protein Properties Length: 194aa    MW: 21207.5 Da    PI: 7.6379
Description ZF-HD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Vang0017s00100.1genomeSNUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1ZF-HD_dimer95.93.3e-302277359
       ZF-HD_dimer  3 kvrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRrevee 59
                      + rY+eC+kNhA+s+GghavDGC+Ef+++ ge+gt +a+ CaAC+CHRnFHR+e + 
  Vang0017s00100.1 22 TSRYRECQKNHAVSIGGHAVDGCCEFLAA-GEDGTLEAVICAACNCHRNFHRKEIDG 77
                      579*************************9.999********************9876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD1257742.0E-21874IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PfamPF047707.1E-282375IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
TIGRFAMsTIGR015667.5E-272475IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PROSITE profilePS5152326.8912574IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
SuperFamilySSF466891.97E-7128165IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.605.4E-16128167IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 194 aa     Download sequence    Send to blast
MSAAEGVPAT VNSGRKGGSA GTSRYRECQK NHAVSIGGHA VDGCCEFLAA GEDGTLEAVI  60
CAACNCHRNF HRKEIDGEIS SYQLRSQPQP QPQPLHPQYH HQFSPYYHRG PPPSSAGYLH  120
PHHLLTTPLG WRIQKHDEAA VEQFCAETCV KRHVLKVWMH NNKHTLANSE QRSAGNGSNH  180
LNSSTIIENS ELS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wh7_A4e-161291653975ZF-HD homeobox family protein
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150350.0AP015035.1 Vigna angularis var. angularis DNA, chromosome 2, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007136351.12e-86hypothetical protein PHAVU_009G037900g
SwissprotQ9SB613e-46ZHD2_ARATH; Zinc-finger homeodomain protein 2
TrEMBLA0A0S3RCZ88e-91A0A0S3RCZ8_PHAAN; Uncharacterized protein
STRINGGLYMA06G09970.13e-59(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF4066522
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G18350.11e-27homeobox protein 24